PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK27745.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family bZIP
Protein Properties Length: 291aa    MW: 32176.4 Da    PI: 6.1434
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK27745.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_151.91.6e-16133179349
                 XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
      bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkel 49 
                 +lkr rrk +NRe+A+rsR+RK+  ++ Le  v++L++eN++L k+l
  KFK27745.1 133 DLKRIRRKFSNRESAKRSRKRKQDHLAGLESQVDSLKGENSTLYKQL 179
                 79*****************************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1708.4E-13128184No hitNo description
SMARTSM003387.8E-15131195IPR004827Basic-leucine zipper domain
PfamPF001701.8E-14133179IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.772133179IPR004827Basic-leucine zipper domain
SuperFamilySSF579594.02E-12134183No hitNo description
CDDcd147022.91E-18136187No hitNo description
PROSITE patternPS000360138153IPR004827Basic-leucine zipper domain
PfamPF124987.4E-5202268IPR020983Basic leucine-zipper, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0071333Biological Processcellular response to glucose stimulus
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 291 aa     Download sequence    Send to blast
MDDHRANDIG MKRSASELAL QELLTKFLSS SRQESVLDTS SLDHSFDLMN RDYTCDLRDS  60
LLLHESLIPH GLFLDAQSSI CENLSADSPV SANKPEVRGE AQRTMSGSFH DHSDEEDAET  120
ELGQSEMNND PNDLKRIRRK FSNRESAKRS RKRKQDHLAG LESQVDSLKG ENSTLYKQLI  180
DATHQFRSAG TNNRVLKSDV ETLRVKVKLA EDLVARGSFT SSLNQLLQTH LSPPSQPINS  240
LHYTGNNSPA ITVHSDQSLF HGITHSGHNS SGPGIGNVSS EAVSCVSDIW P
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1137153RRKFSNRESAKRSRKRK
2147154KRSRKRKQ
3149154SRKRKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013700428.11e-166PREDICTED: basic leucine zipper 9-like
SwissprotQ9FUD31e-162BZIP9_ARATH; Basic leucine zipper 9
TrEMBLA0A087GCZ30.0A0A087GCZ3_ARAAL; Uncharacterized protein
STRINGBra020471.1-P1e-164(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM63702641
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G24800.11e-163basic leucine zipper 9